missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HIV-1 Gag p24 Antibody, Alexa Fluor™ 750, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-41214AF750
This item is not returnable.
View return policy
Description
HIV-1 Gag p24 Polyclonal antibody specifically detects HIV-1 Gag p24 in Virus samples. It is validated for Western Blot, ELISA
Specifications
| HIV-1 Gag p24 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Antibody was raised against a recombinant full-length HIV-1 Gag p24 protein . Amino Acid Squence: pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvla | |
| 0.1 mL | |
| Infections (Virus Bacteria and Parasites) | |
| 155030 | |
| Store at 4°C in the dark. | |
| IgG |
| Western Blot, ELISA | |
| Alexa Fluor 750 | |
| Rabbit | |
| Peptide affinity purified | |
| RUO | |
| Primary | |
| Virus | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
HIV-1 Gag p24 Antibody, Alexa Fluor™ 750, Novus Biologicals™ > 0.1 mL; Alexa Fluor 750
Spot an opportunity for improvement?Share a Content Correction
