missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

For use in research applications

Brand: Novus Biologicals™ NBP2-29331-5MG

View more versions of this product

Product Code. 18146244

1350.00€ / 5mg

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Specifications

Host Species	Human, Mouse
For Use With (Application)	Inhibition of TIRAP binding to TLR2 or TLR4
Quantity	5 mg
Molecular Weight (g/mol)	3701.4
Form	Lyophilized

Components	TIRAP Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS (TIRAP sequence is underlined). Molecular weight: 3701.4. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361.
Content And Storage	Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Product Type	TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
Inhibitors	TLR2, TLR4

Product Suggestions

Customers who viewed this item also viewed. This information does not imply a recommendation or representation of any kind and any action taken upon the information provided is strictly at your own risk. The products shown have not been qualified by Fisher Scientific for any particular purpose, application or use and it is the responsibility of the purchaser to ensure that the performance of the product is suitable for the purchasers specific use or intended application.

Viewing 1-4 of

Catalog No. 10472322

Invitrogen ™ NuPAGE ™ Bis-Tris Mini Protein Gels, 4 Invitrogen ™ NuPAGE ™ Bis-Tris Mini Protein Gels, 4

216,00 € / Each
Catalog No. 10794597

TaqMan® TaqMan ™ Gene Expression Assay (FAM) TaqMan® TaqMan ™ Gene Expression Assay (FAM)

272,00 € / Each
Catalog No. 15860210

Invitrogen ™ Qubit ™ 1X dsDNA High Sensitivit Invitrogen ™ Qubit ™ 1X dsDNA High Sensitivit

417,00 € / Each
Catalog No. 10616763

Invitrogen ™ Qubit ™ dsDNA Quantification Ass Invitrogen ™ Qubit ™ dsDNA Quantification Ass

431,00 € / 1 set
Catalog No. 11832124

Thermo Scientific ™ PageRuler ™ Plus Prestain Thermo Scientific ™ PageRuler ™ Plus Prestain

178,00 € / Pack of 2
Catalog No. 10328162

Invitrogen ™ SYBR ™ Safe DNA Gel Stain Invitrogen ™ SYBR ™ Safe DNA Gel Stain

131,00 € / 400µL
Catalog No. 15955590

Thermo Scientific ™ Pierce ™ Chromogenic Endo Thermo Scientific ™ Pierce ™ Chromogenic Endo

263,00 € / 30 reactions
Catalog No. 10516495

Thermo Scientific ™ Halt ™ Protease Inhibitor Thermo Scientific ™ Halt ™ Protease Inhibitor

137,00 € / 1mL
Catalog No. 10017003

Thermo Scientific ™ RIPA Lysis and Extraction Thermo Scientific ™ RIPA Lysis and Extraction

114,00 € / 100mL
Catalog No. 13505160

Thermo Scientific ™ EpiJET Bisulfite Conversio Thermo Scientific ™ EpiJET Bisulfite Conversio

394,00 € / 50 reactions
Catalog No. 15826258

BD General Caspase Inhibitor, Z-VAD-FMK BD General Caspase Inhibitor, Z-VAD-FMK

416,00 € / Each

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Novus Biologicals™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set > 5mg

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Novus Biologicals™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

Description

Specifications

Product Suggestions

Documents

Promotions

You recently viewed...Show