missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ PPAR gamma/NR1C3 Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Brand: Novus Biologicals™ NBP2-57833PEP
This item is not returnable.
View return policy
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPAR gamma/NR1C3. Source: E.coli Amino Acid Sequence: DYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVC The PPAR gamma/NR1C3 Recombinant Protein Antigen is derived from E. coli. The PPAR gamma/NR1C3 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Specifications
| 5468 | |
| PPAR gamma/NR1C3 Recombinant Protein Antigen | |
| PBS and 1M Urea, pH 7.4 | |
| CIMT1, NR1C3GLM1, Nuclear receptor subfamily 1 group C member 3, peroxisome proliferator-activated receptor gamma, peroxisome proliferator-activated receptor gamma 1, PPAR gamma, PPARG1peroxisome proliferative activated receptor, gamma, PPARG2PPARgamma, P | |
| Unlabeled | |
| 100 μL | |
| E.coli |
| >80% by SDS-PAGE and Coomassie blue staining | |
| Store at −20°C. Avoid freeze-thaw cycles | |
| Blocking/Neutralizing, Control | |
| PPARG | |
| Recombinant Protein Antigen | |
| RUO | |
| This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50015. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Novus Biologicals™ PPAR gamma/NR1C3 Recombinant Protein Antigen > Quantity: 100μL
For research use only.
Spot an opportunity for improvement?Share a Content Correction