missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ AKT1/2/3 Inhibitor Peptide Set
For use in research applications
593.00€ - 1170.00€
Specifications
| Host Species | Human |
|---|---|
| Components | Akt (Isoforms 1,2,3) Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKAVTDHPDRLWAWEKF (AKT sequence: AVTDHPDRLWAWEKF). Molecular weight: 4214. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361 |
| For Use With (Application) | Inhibition of Akt kinase activity |
| Content And Storage | Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. |
| Product Type | AKT1/2/3 Inhibitor Peptide Set |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18145235
|
Novus Biologicals™
NBP2-29332 |
2 mg |
593.00€
2mg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18115332
|
Novus Biologicals™
NBP2-29332-5MG |
5 mg |
1170.00€
5mg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Specifications
| Human | |
| Inhibition of Akt kinase activity | |
| AKT1/2/3 Inhibitor Peptide Set | |
| AKT1/2/3 |
| Akt (Isoforms 1,2,3) Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKAVTDHPDRLWAWEKF (AKT sequence: AVTDHPDRLWAWEKF). Molecular weight: 4214. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| 4214 | |
| Lyophilized |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Novus Biologicals™ AKT1/2/3 Inhibitor Peptide Set