missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ Proline rich 16 Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Brand: Novus Biologicals™ NBP2-13814PEP
This item is not returnable.
View return policy
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRR16. The Proline rich 16 Recombinant Protein Antigen is derived from E. coli. The Proline rich 16 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.This is a blocking peptide for NBP2-13814. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
Specifications
| 51334 | |
| Chromatography | |
| 0.5mg/mL | |
| PBS and 1M Urea, pH 7.4. | |
| PRR16 | |
| 27kDa | |
| 0.1mL | |
| E.Coli | |
| KCEDPKRVVPTANPVKTNGTLLRNGGLPGGPNKIPNGDICCIPNSNLDKAPVQLLMHRPEKDRCPQAGPRERVRFNEKVQYHGYCPDCD |
| Human | |
| >80% | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| Blocking/Neutralizing, Control | |
| Unlabeled | |
| Proline rich 16 | |
| RUO | |
| This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13814. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
For Research Use Only