missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Pin1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
401.00€ - 672.00€
Specifications
| Antigen | Pin1 |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18665404
|
Novus Biologicals
NBP3-21340-100ul |
100 μg |
672.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18684244
|
Novus Biologicals
NBP3-21340-25ul |
25 μg |
401.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Pin1 Polyclonal antibody specifically detects Pin1 in Human samples. It is validated for ImmunofluorescenceSpecifications
| Pin1 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cell Cycle and Replication, Mitotic Regulators, Phospho Specific | |
| PBS, pH 7.2, 40% glycerol | |
| 5300 | |
| IgG | |
| Affinity purified |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| dod, EC 5.2.1.8, peptidyl-prolyl cis/trans isomerase, NIMA-interacting, peptidylprolyl cis/trans isomerase, NIMA-interacting 1, peptidyl-prolyl cis-trans isomerase NIMA-interacting 1, Peptidyl-prolyl cis-trans isomerase Pin1, PPIase Pin1, prolyl isomerase, protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting 1, protein (peptidylprolyl cis/trans isomerase) NIMA-interacting 1, Rotamase Pin1, UBL5 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: RSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title