missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NDUFB3 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93366-0.1ml
This item is not returnable.
View return policy
Description
NDUFB3 Polyclonal antibody specifically detects NDUFB3 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| NDUFB3 | |
| Polyclonal | |
| Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:100 | |
| 3 (12kD, B12), NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 3, 12kDa | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-98 of human NDUFB3 (NP_002482.1). MAHEHGHEHGHHKMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKSVSFSDVFFKGFKWGFAAFVVAVGAEYYLESLNKDKKHH | |
| 0.1 mL | |
| Cancer, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction | |
| 4709 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction