missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human TRPC1 (aa 655-787) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP91251
This item is not returnable.
View return policy
Description
Thought to form a receptor-activated non-selective calcium permeant cation channel. Probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. Seems to be also activated by intracellular calcium store depletion. Interacts with ITPR3. Appears to be ubiquitous.
Specifications
| P48995 | |
| Blocking Assay, Control | |
| 7220 | |
| 100 μL | |
| RUO | |
| Trpc1 | |
| Recombinant | |
| E. coli |
| ≥5.0 mg/mL | |
| 1M urea, PBS with no preservative; pH 7.4 | |
| TRPC1 | |
| -20° C, Avoid Freeze/Thaw Cycles | |
| 3010009O07Rik; AI115608; capacitative calcium channel protein Trp1; capacitative calcium entry channel; HTRP-1; membe; Mtrp1; mTrp2; Short transient receptor potential channel 1; smTRPC2; transient receptor potential canonical 1; transient receptor potential cation channel subfamily C member 1; transient receptor potential cation channel, subfamily C, member 1; transient receptor potential cation channel, subfamily C, member 1 L homeolog; transient receptor potential protein; transient receptor protein 1; trp; TRP1; TRP-1; TRP-1 protein; trp2; trpc1; trpc1.L; TRPC2a; TRPC2b; trp-related protein 1; Trrp1; Trrp2; XELAEV_18027727mg; xtrpc1 | |
| Unconjugated | |
| HEDKEWKFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYMISSLSKWICSHTSKGKVKRQNSLKEWRNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNELRQDLSKFRNEIRDLLGFRTSKYA |