missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human TMEM66 (aa 199-251) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP105987
This item is not returnable.
View return policy
Description
Saraf encodes a protein that is a negative regulator of store-operated Ca(2+) entry (SOCE) involved in protecting cells from Ca(2+) overfilling. In response to cytosolic Ca(2+) elevation after endoplasmic reticulum Ca(2+) refilling, promotes a slow inactivation of STIM (STIM1 or STIM2)-dependent SOCE activity: possibly act by facilitating the de-oligomerization of STIM to efficiently turn off ORAI when the endoplasmic reticulum lumen is filled with the appropriate Ca(2+) levels, and thus preventing the overload of the cell with excessive Ca(2+) ions.
Specifications
| Q96BY9 | |
| Blocking Assay, Control | |
| 51669 | |
| 100 μL | |
| RUO | |
| SARAF | |
| Human | |
| YSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFT | |
| Liquid |
| ≥5.0 mg/mL | |
| 1M urea, PBS with no preservative; pH 7.4 | |
| TMEM66 | |
| -20° C, Avoid Freeze/Thaw Cycles | |
| 1810045K07Rik; arrestin-E; FOAP-7; HBV XAg-transactivated protein 3; HBV X-transactivated gene 3 protein; HSPC035; NPD003; Protein FOAP-7; PSEC0019; Saraf; SARAF long isoform; SARAF short isoform; SOCE-associated regulatory factor; store-operated calcium entry associated regulatory factor; store-operated calcium entry-associated regulatory factor; testicular secretory protein Li 59; TMEM66; Transmembrane protein 66; UNQ1967/PRO4499; XTP3 | |
| Unconjugated | |
| Recombinant | |
| E. coli |