missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TM9SF4 (aa 127-208) Control Fragment Recombinant Protein

Recombinant Protein

Brand: Invitrogen™ RP99324

Product Code. 30181537

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

TM9SF4 is a protein coding gene.

Specifications

Accession Number	Q92544
For Use With (Application)	Blocking Assay, Control
Gene ID (Entrez)	9777
Quantity	100 μL
Regulatory Status	RUO
Gene Symbol	TM9SF4
Species	Human
Sequence	EDYYVHLIADNLPVATRLELYSNRDSDDKKKEKDVQFEHGYRLGFTDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFE
Form	Liquid

Concentration	≥5.0 mg/mL
Formulation	1M urea, PBS with no preservative; pH 7.4
Name	TM9SF4
Storage Requirements	-20° C, Avoid Freeze/Thaw Cycles
Gene Alias	AA986553; AU045326; B930079E06; dinucleotide oxidase disulfide thiol exchanger 3 superfamily member 4; dJ836N17.2; Kiaa0255; LOW QUALITY PROTEIN: transmembrane 9 superfamily member 4; mKIAA0255; TM9SF4; Transmembrane 9 superfamily member 4; transmembrane 9 superfamily protein member 4; TUCAP1; Tumor cannibalism associated protein 1; zgc:66234
Conjugate	Unconjugated
Recombinant	Recombinant
Expression System	E. coli

Product Suggestions

Description