missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TM9SF2 (aa 62-173) Control Fragment Recombinant Protein

Recombinant Protein

Brand: Invitrogen™ RP101011

Product Code. 30209937

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

In the intracellular compartments, may function as a channel or small molecule transporter.

Specifications

Accession Number	Q99805
For Use With (Application)	Blocking Assay, Control
Gene ID (Entrez)	9375
Quantity	100 μL
Regulatory Status	RUO
Gene Symbol	TM9SF2
Species	Human
Sequence	LFVNRLDSVESVLPYEYTAFDFCQASEGKRPSENLGQVLFGERIEPSPYKFTFNKKETCKLVCTKTYHTEKAEDKQKLEFLKKSMLLNYQHHWIVDNMPVTWCYDVEDGQRF
Form	Liquid

Concentration	≥5.0 mg/mL
Formulation	1M urea, PBS with no preservative; pH 7.4
Name	TM9SF2
Storage Requirements	-20° C, Avoid Freeze/Thaw Cycles
Gene Alias	76 kDa membrane protein; dinucleotide oxidase disulfide thiol exchanger 3 superfamily member 2; P76; TM9SF2; Transmembrane 9 superfamily member 2; transmembrane protein 9 superfamily member 2
Conjugate	Unconjugated
Recombinant	Recombinant
Expression System	E. coli

Product Suggestions

Description