missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human QSOX2 (aa 504-633) Control Fragment Recombinant Protein

Recombinant Protein

Brand: Invitrogen™ RP90405

Product Code. 30201528

259.00€ / 100µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

QSOX2 is a member of the sulfhydryl oxidase/quiescin-6 (Q6) family (QSOX1) that regulates the sensitization of neuroblastoma cells for IFN-gamma (IFNG)-induced cell death.

Specifications

Accession Number	Q6ZRP7
For Use With (Application)	Blocking Assay, Control
Gene ID (Entrez)	169714
Quantity	100 μL
Regulatory Status	RUO
Gene Symbol	Qsox2
Species	Human
Sequence	LWKKHNMVNGRLAGHLSEDPRFPKLQWPTPDLCPACHEEIKGLASWDEGHVLTFLKQHYGRDNLLDTYSADQGDSSEGGTLARGEEEEKRLTPPEVSHGDRDTQSVRPPGALGPRPALPESLHHSLDGKL
Form	Liquid

Concentration	≥5.0 mg/mL
Formulation	1M urea, PBS with no preservative; pH 7.4
Name	QSOX2
Storage Requirements	-20° C, Avoid Freeze/Thaw Cycles
Gene Alias	BC030934; neuroblastoma-derived sulfhydryl oxidase; QSCN6L1; QSOX2; quiescin Q6 sulfhydryl oxidase 2; quiescin Q6-like 1; quiescin Q6-like protein 1; quiescin sulfhydryl oxidase 2; SOXN; Sulfhydryl oxidase 2; thiol oxidase 2
Conjugate	Unconjugated
Recombinant	Recombinant
Expression System	E. coli

Product Suggestions

Invitrogen™ Human QSOX2 (aa 504-633) Control Fragment Recombinant Protein

Description

Specifications

Product Suggestions

Documents

Promotions