missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human QSOX2 (aa 504-633) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP90405
This item is not returnable.
View return policy
Description
QSOX2 is a member of the sulfhydryl oxidase/quiescin-6 (Q6) family (QSOX1) that regulates the sensitization of neuroblastoma cells for IFN-gamma (IFNG)-induced cell death.Specifications
Q6ZRP7 | |
Blocking Assay, Control | |
169714 | |
100 μL | |
RUO | |
Qsox2 | |
Human | |
LWKKHNMVNGRLAGHLSEDPRFPKLQWPTPDLCPACHEEIKGLASWDEGHVLTFLKQHYGRDNLLDTYSADQGDSSEGGTLARGEEEEKRLTPPEVSHGDRDTQSVRPPGALGPRPALPESLHHSLDGKL | |
Liquid |
≥5.0 mg/mL | |
1M urea, PBS with no preservative; pH 7.4 | |
QSOX2 | |
-20° C, Avoid Freeze/Thaw Cycles | |
BC030934; neuroblastoma-derived sulfhydryl oxidase; QSCN6L1; QSOX2; quiescin Q6 sulfhydryl oxidase 2; quiescin Q6-like 1; quiescin Q6-like protein 1; quiescin sulfhydryl oxidase 2; SOXN; Sulfhydryl oxidase 2; thiol oxidase 2 | |
Unconjugated | |
Recombinant | |
E. coli |