missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human QSOX2 (aa 193-315) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP105740
This item is not returnable.
View return policy
Description
QSOX2 is a member of the sulfhydryl oxidase/quiescin-6 (Q6) family (QSOX1) that regulates the sensitization of neuroblastoma cells for IFN-gamma (IFNG)-induced cell death.
Specifications
| Q6ZRP7 | |
| Blocking Assay, Control | |
| 169714 | |
| 100 μL | |
| RUO | |
| Qsox2 | |
| Human | |
| PIQPSDVLSLLDNRGSHYVAIVFESNSSYLGREVILDLIPYESIVVTRALDGDKAFLEKLGVSSVPSCYLIYPNGSHGLINVVKPLRAFFSSYLKSLPDVRKKSLPLPEKPHKEENSEIVVWR | |
| Liquid |
| ≥5.0 mg/mL | |
| 1M urea, PBS with no preservative; pH 7.4 | |
| QSOX2 | |
| -20° C, Avoid Freeze/Thaw Cycles | |
| BC030934; neuroblastoma-derived sulfhydryl oxidase; QSCN6L1; QSOX2; quiescin Q6 sulfhydryl oxidase 2; quiescin Q6-like 1; quiescin Q6-like protein 1; quiescin sulfhydryl oxidase 2; SOXN; Sulfhydryl oxidase 2; thiol oxidase 2 | |
| Unconjugated | |
| Recombinant | |
| E. coli |