missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Nectin 2 (aa 34-157) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP90206
This item is not returnable.
View return policy
Description
This gene encodes a single-pass type I membrane glycoprotein with two Ig-like C2-type domains and an Ig-like V-type domain. This protein is one of the plasma membrane components of adherens junctions. It also serves as an entry for certain mutant strains of herpes simplex virus and pseudorabies virus, and it is involved in cell to cell spreading of these viruses. Variations in this gene have been associated with differences in the severity of multiple sclerosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.![TRUSTED_SUSTAINABILITY](/content/dam/fishersci/glyphs/Sustain_Badge.png)
Specifications
Q92692 | |
Blocking Assay, Control | |
5819 | |
100 μL | |
RUO | |
NECTIN2 | |
Human | |
VRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLR | |
Liquid |
≥5.0 mg/mL | |
1M urea, PBS with no preservative; pH 7.4 | |
Nectin 2 | |
-20° C, Avoid Freeze/Thaw Cycles | |
AI325026; AI987993; CD112; herpes virus entry mediator B; Herpesvirus entry mediator B; herpesvirus entry protein B; hveB; mHveB; MPH; Murine herpes virus entry protein B; murine herpesvirus entry protein B; nectin cell adhesion molecule 2; Nectin2; Nectin-2; Poliovirus receptor homolog; poliovirus receptor related 2; poliovirus receptor-like 2; poliovirus receptor-related 2; poliovirus receptor-related 2 (herpesvirus entry mediator B); poliovirus receptor-related protein 2; poliovirus sensitivity; PRR2; Pvr; Pvrl2; PVRR2; Pvs | |
Unconjugated | |
Recombinant | |
E. coli |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction