missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human LGSN (aa 223-313) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP94881
This item is not returnable.
View return policy
Description
May act as a component of the cytoskeleton or as a chaperone for the reorganization of intermediate filament proteins during terminal differentiation in the lens. Does not seem to have enzymatic activity.
Specifications
| Q5TDP6 | |
| Blocking Assay, Control | |
| 51557 | |
| 100 μL | |
| RUO | |
| LGSN | |
| Human | |
| IISFPALTFLNNHDQPFMQELVDGLYHTGANVESFSSSTRPGQMEISFLPEFGISSADNAFTLRTGVKEVARKYNYIASFFIETGFCDSGI | |
| Liquid |
| ≥5.0 mg/mL | |
| 1M urea, PBS with no preservative; pH 7.4 | |
| LGSN | |
| -20° C, Avoid Freeze/Thaw Cycles | |
| GLULD1; glutamate-ammonia ligase (glutamine synthase) domain containing 1; glutamate-ammonia ligase domain-containing protein 1; Lengsin; lengsin, lens protein with glutamine synthetase domain; Lens glutamine synthase-like; LGS; LGSN | |
| Unconjugated | |
| Recombinant | |
| E. coli |