missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human IFI30 (aa 98-233) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP88741
This item is not returnable.
View return policy
Description
The protein encoded by this gene is a lysosomal thiol reductase that at low pH can reduce protein disulfide bonds. The enzyme is expressed constitutively in antigen-presenting cells and induced by gamma-interferon in other cell types. This enzyme has an important role in MHC class II-restricted antigen processing.
Specifications
| P13284 | |
| Blocking Assay, Control | |
| 10437 | |
| 100 μL | |
| RUO | |
| IFI30 | |
| Human | |
| LVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKK | |
| Liquid |
| ≥5.0 mg/mL | |
| 1M urea, PBS with no preservative; pH 7.4 | |
| IFI30 | |
| -20° C, Avoid Freeze/Thaw Cycles | |
| Gamma-interferon-inducible lysosomal thiol reductase; gamma-interferon-inducible protein IP-30; GILT; IFI30; IFI-30; IFI30, lysosomal thiol reductase; interferon gamma inducible protein 30; interferon gamma-inducible protein 30 preproprotein; interferon, gamma-inducible protein 30; IP30; IP-30; Legumaturain | |
| Unconjugated | |
| Recombinant | |
| E. coli |