missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human HERPUD1 (aa 22-132) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP98600
This item is not returnable.
View return policy
Description
The accumulation of unfolded proteins in the endoplasmic reticulum (ER) triggers the ER stress response. This response includes the inhibition of translation to prevent further accumulation of unfolded proteins, the increased expression of proteins involved in polypeptide folding, known as the unfolded protein response (UPR), and the destruction of misfolded proteins by the ER-associated protein degradation (ERAD) system. This gene may play a role in both UPR and ERAD. Its expression is induced by UPR and it has an ER stress response element in its promoter region while the encoded protein has an N-terminal ubiquitin-like domain which may interact with the ERAD system. This protein has been shown to interact with presenilin proteins and to increase the level of amyloid-beta protein following its overexpression. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms. The full-length nature of all transcript variants has not been determined.Specifications
Q15011 | |
Blocking Assay, Control | |
9709 | |
100 μL | |
RUO | |
HERPUD1 | |
Human | |
RDLELSGDRGWSVGHLKAHLSRVYPERPRPEDQRLIYSGKLLLDHQCLRDLLPKQEKRHVLHLVCNVKSPSKMPEINAKVAESTEEPAGSNRGQYPEDSSSDGLRQREVLR | |
Liquid |
≥5.0 mg/mL | |
1M urea, PBS with no preservative; pH 7.4 | |
HERPUD1 | |
-20° C, Avoid Freeze/Thaw Cycles | |
Herp; HERPUD1; homocysteine inducible ER protein with ubiquitin like domain 1; homocysteine-inducible endoplasmic reticulum stress-inducible ubiquitin-like domain member 1 protein; homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1; homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein; KIAA0025; Methyl methanesulfonate (MMF)-inducible fragment protein 1; Mif1; Mifl; MMS-inducible; Sup | |
Unconjugated | |
Recombinant | |
E. coli |