missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human GLRX (aa 57-88) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP104818
This item is not returnable.
View return policy
Description
Glutaredoxin (Grx), also known as thiol transferase, is a small heat-stable oxidoreductase. Grxs form part of the glutaredoxin system, comprising NADPH, GSH and glutathione reductase, which transfers electrons from NADPH to glutaredoxins via GSH. First recovered in E.coli as GSH-dependent hydrogen donors for ribonucleotide reductase, Grx catalyzes GSH-disulfide oxidoreductase via two redox-active cysteine residues. The active sequence (Cys-Pro-Tyr-Cys) is conserved in a variety of species. The 12-kDa dithiol protein has a role in reduction of mixed disulfides in cells exposed to oxidative stress.
Specifications
| P35754 | |
| Blocking Assay, Control | |
| 2745 | |
| 100 μL | |
| RUO | |
| GLRX | |
| Human | |
| IQDYLQQLTGARTVPRVFIGKDCIGGCSDLVS | |
| Liquid |
| ≥5.0 mg/mL | |
| 1M urea, PBS with no preservative; pH 7.4 | |
| GLRX | |
| -20° C, Avoid Freeze/Thaw Cycles | |
| C86710; D13Wsu156e; GLRX; Glrx1; GLRXL; glutaredoxin; glutaredoxin (thioltransferase); glutaredoxin 1; glutaredoxin 1 (thioltransferase); Glutaredoxin1; glutaredoxin-1; Grx; Grx 1; Grx1; MGC117; MGC117407; thiol disulfide oxidoreductase; thioltransferase; Thioltransferase 1; thioltransferase; TTase; Thioltransferase1; Thioltransferase-1; TTase; TTase 1; TTase1; TTase-1; TTF; Unknown (protein for MGC:133817) | |
| Unconjugated | |
| Recombinant | |
| E. coli |