missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ENOX1 (aa 465-559) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP97924
This item is not returnable.
View return policy
Description
Probably acts as a terminal oxidase of plasma electron transport from cytosolic NAD(P)H via hydroquinones to acceptors at the cell surface. Hydroquinone oxidase activity alternates with a protein disulfide-thiol interchange/oxidoreductase activity which may control physical membrane displacements associated with vesicle budding or cell enlargement. The activities oscillate with a period length of 24 minutes and play a role in control of the ultradian cellular biological clock.
Specifications
| Q8TC92 | |
| Blocking Assay, Control | |
| 55068 | |
| 100 μL | |
| RUO | |
| ENOX1 | |
| Human | |
| TKDQQLQFLQQTMQGMQQQLLTIQEELNNKKSELEQAKEEQSHTQALLKVLQEQLKGTKELVETNGHSHEDSNEINVLTVALVNQDRENNIEKRS | |
| Liquid |
| ≥5.0 mg/mL | |
| 1M urea, PBS with no preservative; pH 7.4 | |
| ENOX1 | |
| -20° C, Avoid Freeze/Thaw Cycles | |
| bA64J21.1; candidate growth-related and time keeping constitutive hydroquinone (NADH) oxidase; candidate growth-related and time keeping constitutive hydroquinone [NADH] oxidase; cCNOX; Cell proliferation-inducing gene 38 protein; CNOX; Constitutive Ecto-NOX; ecto-NOX disulfide-thiol exchanger 1; ENOX1; Hydroquinone [NADH] oxidase; PIG38; Protein disulfide-thiol oxidoreductase | |
| Unconjugated | |
| Recombinant | |
| E. coli |