missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Desmoplakin (aa 105-194) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP103869
This item is not returnable.
View return policy
Description
Desmoplakin (DSP) is a major high molecular weight protein of the desmosomes. It is involved in the organization of the desmosomal cadherin-plakoglobin complexes into discrete plasma membrane domains and in the anchoring of intermediate filaments to the desmosomes. Desmoplakin mutations are associated with Keratoderma and cardiomyopathy.
Specifications
| P15924 | |
| Blocking Assay, Control | |
| 1832 | |
| 100 μL | |
| RUO | |
| DSP | |
| Human | |
| RELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGW | |
| Liquid |
| ≥5.0 mg/mL | |
| 1M urea, PBS with no preservative; pH 7.4 | |
| Desmoplakin | |
| -20° C, Avoid Freeze/Thaw Cycles | |
| 2300002E22Rik; 250/210 kDa paraneoplastic pemphigus antigen; 5730453H04Rik; AA407887; AA407888; AW109828; DCWHKTA; dermatan sulfate proteoglycan 3; desmoplakin; desmoplakin I/II; Desmoplakin II; desmoplakin; LOW QUALITY PROTEIN: desmoplakin; Desmoplakin-I; desmosomal cytoskeletal connector molecule; DP; Dsp; dspg3; Oculoglycan; Opt; Optc; optcl; Opticin; rul; SLRP; SLRP protein; small leucine-rich repeat protein; small leucine-rich repeat protein (SLRP); wu:fb81a05; zgc:101047 | |
| Unconjugated | |
| Recombinant | |
| E. coli |