missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Cystatin B (aa 22-96) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP91781
This item is not returnable.
View return policy
Description
Cystatin A (also designated STF1, STFA, stefin A or cystatin AS) and cystatin B (also designated PME, CST6, STFB, CPI-B, stefin B and liver thiol proteinase inhibitor) are thiol protease inhibitors that form complexes with Papain and the cathepsins B, H and L. Cystatin A, a cytoplasmic protein, is one of the precursor proteins of the cornified cell envelope in keratinocytes and plays a role in epidermal development and maintenance. Cystatin B protects against intracellular proteases leaking out of lysosomes and is primarily expressed in heart, liver and kidney.Specifications
P04080 | |
Blocking Assay, Control | |
1476 | |
100 μL | |
RUO | |
CSTB | |
Human | |
QVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELT | |
Liquid |
≥5.0 mg/mL | |
1M urea, PBS with no preservative; pH 7.4 | |
Cystatin B | |
-20° C, Avoid Freeze/Thaw Cycles | |
AA960480; CPI-B; Cst6; CSTB; Cyb; cystatin B; cystatin B (stefin B); cystatin B protein; cystatin beta; cystatin-B; Cystatin-beta; Epm1; EPM1A; Liver thiol proteinase inhibitor; LOC101123010; PME; stefin B; Stefin-B; stefin-C; Stfb; ULD; Unknown (protein for MGC:134609) | |
Unconjugated | |
Recombinant | |
E. coli |