Learn More
Invitrogen™ Human Complement C5 (aa 1302-1432) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP95393
Description
Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
C5 (Complement C5) is a Protein Coding gene. Diseases associated with C5 include Complement Component 5 Deficiency and Eculizumab, Poor Response To. Among its related pathways are GPCR downstream signalling and Acquired partial lipodystrophy / Barraquer-Simons syndrome. Gene Ontology (GO) annotations related to this gene include signaling receptor binding and endopeptidase inhibitor activity. An important paralog of this gene is C3. This gene encodes a component of the complement system, a part of the innate immune system that plays an important role in inflammation, host homeostasis, and host defense against pathogens. The encoded preproprotein is proteolytically processed to generate multiple protein products, including the C5 alpha chain, C5 beta chain, C5a anaphylatoxin and C5b. The C5 protein is comprised of the C5 alpha and beta chains, which are linked by a disulfide bridge. Cleavage of the alpha chain by a convertase enzyme results in the formation of the C5a anaphylatoxin, which possesses potent spasmogenic and chemotactic activity, and the C5b macromolecular cleavage product, a subunit of the membrane attack complex (MAC). Mutations in this gene cause complement component 5 deficiency, a disease characterized by recurrent bacterial infections. Alternative splicing results in multiple transcript variants.
Specifications
P01031 | |
Blocking Assay, Control | |
727 | |
100 μL | |
anaphylatoxin; anaphylatoxin C5; anaphylatoxin C5a analog; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4; C5; C5a; C5a anaphylatoxin; C5b; C5D; Complement C5; Complement C5 alpha chain; Complement C5 alpha' chain; Complement C5 beta chain; complement component 5; CPAMD4; ECLZB; Hc; He; hemolytic complement; prepro-C5; RGD1561905 | |
C5 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human Complement C5 (aa 1302-1432) Control Fragment | |
RUO | |
Complement C5 | |
Unconjugated | |
Recombinant | |
LLVKQLRLSMDIDVSYKHKGALHNYKMTDKNFLGRPVEVLLNDDLIVSTGFGSGLATVHVTTVVHKTSTSEEVCSFYLKIDTQDIEASHYRGYGNSDYKRIVACASYKPSREESSSGSSHAVMDISLPTGI | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Product Suggestions
Customers who viewed this item also viewed
Your input is important to us. Please complete this form to provide feedback related to the content on this product.