missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human CNKSR3 (aa 387-471) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP104139
This item is not returnable.
View return policy
Description
CNKSR3 may be involved in transepithelial sodium transport. Regulates aldosterone-induced and ENaC-mediated sodium transport possibly through regulation of the ERK pathway.
Specifications
| Q6P9H4 | |
| Blocking Assay, Control | |
| 154043 | |
| 100 μL | |
| RUO | |
| CNKSR3 | |
| Human | |
| FLDQESRRRRFTIADSDQLPGYSVETNILPTKMREKTPSYGKPRPLSMPADGNWMGIVDPFARPRGHGRKGEDALCRYFSNERIP | |
| Liquid |
| ≥5.0 mg/mL | |
| 1M urea, PBS with no preservative; pH 7.4 | |
| CNKSR3 | |
| -20° C, Avoid Freeze/Thaw Cycles | |
| 6820402C05; BC024086; CNK homolog protein 3; CNK3; CNKSR family member 3; Cnksr3; Connector enhancer of kinase suppressor of ras 3; connector enhancer of KSR 3; KOX14; MAGI1; maguin-like protein; membrane associated guanylate kinase interacting protein-like 1; membrane associated guanylate kinase, WW and PDZ domain containing 1; membrane-associated guanylate kinase-interacting protein-like 1; parturition-related protein 4; Prp4; ZNF21 | |
| Unconjugated | |
| Recombinant | |
| E. coli |