missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Calpain 11 (aa 547-629) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP94868
This item is not returnable.
View return policy
Description
The calpains including Calpain 1 (CAPN1), calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes the large subunit of the ubiquitous enzyme, calpain 1. Several transcript variants encoding two different isoforms have been found for this gene. Diseases associated with CAPN1 include Spastic Paraplegia 76, Autosomal Recessive and Spasticity.Specifications
Q9UMQ6 | |
Blocking Assay, Control | |
11131 | |
100 μL | |
RUO | |
CAPN11 | |
Human | |
WELDEVNYAEQLQEEKVSEDDMDQDFLHLFKIVAGEGKEIGVYELQRLLNRMAIKFKSFKTKGFGLDACRCMINLMDKDGSGK | |
Liquid |
≥5.0 mg/mL | |
1M urea, PBS with no preservative; pH 7.4 | |
Calpain 11 | |
-20° C, Avoid Freeze/Thaw Cycles | |
calcium-activated neutral proteinase 11; calcium-activated neutral proteinase 11 {ECO:0000250; calcium-dependent thiol protease; calpain 11; calpain 11 {ECO:0000312; calpain11; Calpain-11; calpain-11; LOW QUALITY PROTEIN: calpain-11; CANP 11; CANP 11 {ECO:0000250; Capn11; capn11 {ECO:0000312; EMBL:AAH97256.1}; HIP2; LIG; RGD:1302946}; UniProtKB:Q9UMQ6} | |
Unconjugated | |
Recombinant | |
E. coli |