missing translation for 'onlineSavingsMsg'
Learn More
Learn More
E74 like factor 1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
463.00€
Specifications
| Antigen | E74 like factor 1 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry |
| Applications | Western Blot, Immunohistochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
E74 like factor 1 Polyclonal specifically detects E74 like factor 1 in Human samples. It is validated for Western Blot, Immunohistochemistry.Specifications
| E74 like factor 1 | |
| Western Blot, Immunohistochemistry | |
| Unconjugated | |
| Rabbit | |
| Cellular Markers | |
| PBS buffer, 2% sucrose | |
| 1997 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml, Immunohistochemistry | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| E74-like factor 1, E74-like factor 1 (ets domain transcription factor), ETS-related transcription factor Elf-1 | |
| The immunogen is a synthetic peptide directed towards the N terminal region of human E74 like factor 1 (NP_758961). Peptide sequence VTLDGIPEVMETQQVQEKYADSPGASSPEQPKRKKGRKTKPPRPDSPATT | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title